Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.110: Profilin-like [55769] (6 superfamilies) |
Superfamily d.110.6: Clathrin coat assembly domain [75520] (1 family) |
Family d.110.6.1: Clathrin coat assembly domain [75521] (2 proteins) |
Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [75525] (1 PDB entry) |
Domain d1gw5s_: 1gw5 S: [70633] Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m1, d1gw5m2 |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOP Domain Sequences for d1gw5s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw5s_ d.110.6.1 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus)} mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla geiretsqtkvlkqllmlqsle
Timeline for d1gw5s_:
View in 3D Domains from other chains: (mouse over for more information) d1gw5a_, d1gw5b_, d1gw5m1, d1gw5m2 |