Lineage for d1gw0b3 (1gw0 B:344-559)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162779Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 162814Protein Laccase [49557] (4 species)
  7. 162822Species Melanocarpus albomyces [TaxId:204285] [74873] (1 PDB entry)
  8. 162828Domain d1gw0b3: 1gw0 B:344-559 [70628]

Details for d1gw0b3

PDB Entry: 1gw0 (more details), 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form

SCOP Domain Sequences for d1gw0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw0b3 b.6.1.3 (B:344-559) Laccase {Melanocarpus albomyces}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

SCOP Domain Coordinates for d1gw0b3:

Click to download the PDB-style file with coordinates for d1gw0b3.
(The format of our PDB-style files is described here.)

Timeline for d1gw0b3: