SCOP 1.63: Domain d1gw0b1: 1gw0 B:1-162

Lineage for d1gw0b1 (1gw0 B:1-162)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Laccase [49557] (4 species)
   consists of three domains of this fold

7. Species Melanocarpus albomyces [TaxId:204285] [74873] (1 PDB entry)

8. Domain d1gw0b1: 1gw0 B:1-162 [70626]

Details for d1gw0b1

PDB Entry: 1gw0, 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form

SCOP Domain Sequences for d1gw0b1:

Sequence; same for both SEQRES and ATOM records:

>d1gw0b1 b.6.1.3 (B:1-162) Laccase {Melanocarpus albomyces}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

Timeline for d1gw0b1:

• d1gw0b1 first appeared in SCOP 1.61
  
• d1gw0b1 appears in SCOP 1.65
  
• d1gw0b1 appears in the current release, SCOPe 2.08