Lineage for d1gw0b1 (1gw0 B:1-162)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224695Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 224730Protein Laccase [49557] (4 species)
    consists of three domains of this fold
  7. 224738Species Melanocarpus albomyces [TaxId:204285] [74873] (1 PDB entry)
  8. 224742Domain d1gw0b1: 1gw0 B:1-162 [70626]

Details for d1gw0b1

PDB Entry: 1gw0 (more details), 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form

SCOP Domain Sequences for d1gw0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw0b1 b.6.1.3 (B:1-162) Laccase {Melanocarpus albomyces}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOP Domain Coordinates for d1gw0b1:

Click to download the PDB-style file with coordinates for d1gw0b1.
(The format of our PDB-style files is described here.)

Timeline for d1gw0b1: