Lineage for d1gvva_ (1gvv A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 169255Family b.50.1.2: Pepsin-like [50646] (9 protein domains)
  6. 169336Protein Endothiapepsin [50647] (1 species)
  7. 169337Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (32 PDB entries)
  8. 169342Domain d1gvva_: 1gvv A: [70620]

Details for d1gvva_

PDB Entry: 1gvv (more details), 1.05 Å

PDB Description: five atomic resolution structures of endothiapepsin inhibitor complexes; implications for the aspartic proteinase mechanism

SCOP Domain Sequences for d1gvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvva_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d1gvva_:

Click to download the PDB-style file with coordinates for d1gvva_.
(The format of our PDB-style files is described here.)

Timeline for d1gvva_: