Lineage for d1gvmf_ (1gvm F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086002Fold b.109: beta-hairpin stack [69359] (1 superfamily)
    Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn
  4. 2086003Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) (S)
  5. 2086004Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
    this is a repeat family; one repeat unit is 2bib A:415-315 found in domain
  6. 2086009Protein Choline binding domain of autolysin C-LytA [69362] (1 species)
  7. 2086010Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69363] (4 PDB entries)
  8. 2086020Domain d1gvmf_: 1gvm F: [70617]
    complexed with cht, ddq, trs

Details for d1gvmf_

PDB Entry: 1gvm (more details), 2.8 Å

PDB Description: choline binding domain of the major autolysin (c-lyta) from streptococcus pneumoniae
PDB Compounds: (F:) autolysin

SCOPe Domain Sequences for d1gvmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvmf_ b.109.1.1 (F:) Choline binding domain of autolysin C-LytA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ggivhsdgsypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkki
adkwyyfneegamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladr
peftvepdglitvk

SCOPe Domain Coordinates for d1gvmf_:

Click to download the PDB-style file with coordinates for d1gvmf_.
(The format of our PDB-style files is described here.)

Timeline for d1gvmf_: