Lineage for d1gvmc_ (1gvm C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821108Fold b.109: beta-hairpin stack [69359] (1 superfamily)
    Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn
  4. 2821109Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) (S)
  5. 2821110Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
    this is a repeat family; one repeat unit is 2bib A:415-315 found in domain
  6. 2821115Protein Choline binding domain of autolysin C-LytA [69362] (1 species)
  7. 2821116Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69363] (4 PDB entries)
  8. 2821119Domain d1gvmc_: 1gvm C: [70614]
    complexed with cht, ddq, trs

Details for d1gvmc_

PDB Entry: 1gvm (more details), 2.8 Å

PDB Description: choline binding domain of the major autolysin (c-lyta) from streptococcus pneumoniae
PDB Compounds: (C:) autolysin

SCOPe Domain Sequences for d1gvmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvmc_ b.109.1.1 (C:) Choline binding domain of autolysin C-LytA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gsypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyf
neegamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvep
dglitvk

SCOPe Domain Coordinates for d1gvmc_:

Click to download the PDB-style file with coordinates for d1gvmc_.
(The format of our PDB-style files is described here.)

Timeline for d1gvmc_: