Lineage for d1gvla_ (1gvl A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953696Protein Kallikrein 6 [74974] (1 species)
  7. 953697Species Human (Homo sapiens) [TaxId:9606] [74975] (3 PDB entries)
  8. 953700Domain d1gvla_: 1gvl A: [70611]
    proenzyme

Details for d1gvla_

PDB Entry: 1gvl (more details), 1.8 Å

PDB Description: human prokallikrein 6 (hk6)/ prozyme/ proprotease m/ proneurosin
PDB Compounds: (A:) kallikrein 6

SCOPe Domain Sequences for d1gvla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvla_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
klvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlrqq
essqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschi
lgwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggp
lvcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

SCOPe Domain Coordinates for d1gvla_:

Click to download the PDB-style file with coordinates for d1gvla_.
(The format of our PDB-style files is described here.)

Timeline for d1gvla_: