Lineage for d1gvkb_ (1gvk B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Elastase [50536] (4 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (54 PDB entries) 
Domain d1gvkb_: 1gvk B: [70610]
Details for d1gvkb_
PDB Entry: 1gvk (more details), 0.94 Å
PDB Description: porcine pancreatic elastase acyl enzyme at 0.95 a resolution
SCOP Domain Sequences for d1gvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1gvkb_:
Click to download the PDB-style file with coordinates for d1gvkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gvkb_:
- d1gvkb_ is new in SCOP 1.61
- d1gvkb_ appears in SCOP 1.63
- d1gvkb_ appears in the current release, SCOPe 2.08
View in 3D