SCOPe 2.08: Domain d1gvia3: 1gvi A:124-505

Lineage for d1gvia3 (1gvi A:124-505)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Thermus sp. [TaxId:275] [51466] (2 PDB entries)

8. Domain d1gvia3: 1gvi A:124-505 [70606]
   Other proteins in same PDB: d1gvia1, d1gvia2, d1gvib1, d1gvib2
   has additional subdomain(s) that are not in the common domain

Details for d1gvia3

PDB Entry: 1gvi, 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd

PDB Compounds: (A:) maltogenic amylase

SCOPe Domain Sequences for d1gvia3:

Sequence; same for both SEQRES and ATOM records:

>d1gvia3 c.1.8.1 (A:124-505) Maltogenic amylase, central domain {Thermus sp. [TaxId: 275]}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

Timeline for d1gvia3:

• d1gvia3 first appeared in SCOP 1.61
  
• d1gvia3 appears in SCOPe 2.07