SCOPe 2.05: Domain d1gvia2: 1gvi A:506-588

Lineage for d1gvia2 (1gvi A:506-588)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermus sp. [TaxId:275] [51032] (2 PDB entries)

8. Domain d1gvia2: 1gvi A:506-588 [70605]
   Other proteins in same PDB: d1gvia1, d1gvia3, d1gvib1, d1gvib3
   complexed with bcd

Details for d1gvia2

PDB Entry: 1gvi, 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd

PDB Compounds: (A:) maltogenic amylase

SCOPe Domain Sequences for d1gvia2:

Sequence; same for both SEQRES and ATOM records:

>d1gvia2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

Timeline for d1gvia2:

• d1gvia2 first appeared in SCOP 1.61
  
• d1gvia2 appears in SCOPe 2.04
  
• d1gvia2 appears in SCOPe 2.06
  
• d1gvia2 appears in the current release, SCOPe 2.08