| Class b: All beta proteins [48724] (165 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltogenic amylase [51031] (4 species) |
| Species Thermus sp. [TaxId:275] [51032] (2 PDB entries) |
| Domain d1gvia2: 1gvi A:506-588 [70605] Other proteins in same PDB: d1gvia1, d1gvia3, d1gvib1, d1gvib3 |
PDB Entry: 1gvi (more details), 3.3 Å
SCOP Domain Sequences for d1gvia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvia2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw
Timeline for d1gvia2: