Lineage for d1gvia2 (1gvi A:506-588)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 676035Protein Maltogenic amylase [51031] (4 species)
  7. 676083Species Thermus sp. [TaxId:275] [51032] (2 PDB entries)
  8. 676084Domain d1gvia2: 1gvi A:506-588 [70605]
    Other proteins in same PDB: d1gvia1, d1gvia3, d1gvib1, d1gvib3

Details for d1gvia2

PDB Entry: 1gvi (more details), 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd
PDB Compounds: (A:) maltogenic amylase

SCOP Domain Sequences for d1gvia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvia2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

SCOP Domain Coordinates for d1gvia2:

Click to download the PDB-style file with coordinates for d1gvia2.
(The format of our PDB-style files is described here.)

Timeline for d1gvia2: