Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
Species Thermus sp. [TaxId:275] [49222] (2 PDB entries) |
Domain d1gvia1: 1gvi A:1-123 [70604] Other proteins in same PDB: d1gvia2, d1gvia3, d1gvib2, d1gvib3 |
PDB Entry: 1gvi (more details), 3.3 Å
SCOP Domain Sequences for d1gvia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvia1 b.1.18.2 (A:1-123) Maltogenic amylase, N-terminal domain N {Thermus sp.} mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl hrv
Timeline for d1gvia1: