Lineage for d1gvha3 (1gvh A:254-396)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178377Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 178378Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 178477Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein)
  6. 178478Protein Flavohemoglobin, C-terminal domain [52371] (2 species)
  7. 178482Species Escherichia coli [TaxId:562] [75158] (1 PDB entry)
  8. 178483Domain d1gvha3: 1gvh A:254-396 [70603]
    Other proteins in same PDB: d1gvha1, d1gvha2

Details for d1gvha3

PDB Entry: 1gvh (more details), 2.19 Å

PDB Description: the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket

SCOP Domain Sequences for d1gvha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli}
mavaddtpvtlisagvgqtpmlamldtlakaghtaqvnwfhaaengdvhafadevkelgq
slprftahtwyrqpseadrakgqfdseglmdlsklegafsdptmqfylcgpvgfmqftak
qlvdlgvkqenihyecfgphkvl

SCOP Domain Coordinates for d1gvha3:

Click to download the PDB-style file with coordinates for d1gvha3.
(The format of our PDB-style files is described here.)

Timeline for d1gvha3: