Lineage for d1gvha2 (1gvh A:147-253)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793612Protein Flavohemoglobin, central domain [50436] (2 species)
    contains additional globin domain
  7. 2793616Species Escherichia coli [TaxId:562] [74961] (1 PDB entry)
  8. 2793617Domain d1gvha2: 1gvh A:147-253 [70602]
    Other proteins in same PDB: d1gvha1, d1gvha3
    complexed with cl, fad, hem, na

Details for d1gvha2

PDB Entry: 1gvh (more details), 2.19 Å

PDB Description: the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket
PDB Compounds: (A:) flavohemoprotein

SCOPe Domain Sequences for d1gvha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]}
ggwegtrdfrivaktprsalitsfelepvdggavaeyrpgqylgvwlkpegfphqeirqy
sltrkpdgkgyriavkreeggqvsnwlhnhanvgdvvklvapagdff

SCOPe Domain Coordinates for d1gvha2:

Click to download the PDB-style file with coordinates for d1gvha2.
(The format of our PDB-style files is described here.)

Timeline for d1gvha2: