Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Flavohemoglobin, central domain [50436] (2 species) contains additional globin domain |
Species Escherichia coli [TaxId:562] [74961] (1 PDB entry) |
Domain d1gvha2: 1gvh A:147-253 [70602] Other proteins in same PDB: d1gvha1, d1gvha3 complexed with cl, fad, hem, na |
PDB Entry: 1gvh (more details), 2.19 Å
SCOPe Domain Sequences for d1gvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} ggwegtrdfrivaktprsalitsfelepvdggavaeyrpgqylgvwlkpegfphqeirqy sltrkpdgkgyriavkreeggqvsnwlhnhanvgdvvklvapagdff
Timeline for d1gvha2: