![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Flavohemoglobin, N-terminal domain [46528] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [74663] (1 PDB entry) |
![]() | Domain d1gvha1: 1gvh A:1-146 [70601] Other proteins in same PDB: d1gvha2, d1gvha3 complexed with cl, fad, hem, na |
PDB Entry: 1gvh (more details), 2.19 Å
SCOPe Domain Sequences for d1gvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} mldaqtiatvkatipllvetgpkltahfydrmfthnpelkeifnmsnqrngdqrealfna iaayasnienlpallpavekiaqkhtsfqikpeqynivgehllatldemfspgqevldaw gkaygvlanvfinreaeiynenaska
Timeline for d1gvha1: