Lineage for d1gvfb_ (1gvf B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174007Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 174176Family c.1.10.2: Class II aldolase [51591] (2 protein domains)
  6. 174184Protein Tagatose-1,6-bisphosphate aldolase [75087] (1 species)
  7. 174185Species Escherichia coli [TaxId:562] [75088] (1 PDB entry)
  8. 174187Domain d1gvfb_: 1gvf B: [70600]

Details for d1gvfb_

PDB Entry: 1gvf (more details), 1.45 Å

PDB Description: structure of tagatose-1,6-bisphosphate aldolase

SCOP Domain Sequences for d1gvfb_:

Sequence, based on SEQRES records: (download)

>d1gvfb_ c.1.10.2 (B:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli}
siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
dfchsqdcsveaelgrlggveddmsvdaesafltdpqeakrfveltgvdslavaigtahg
lysktpkidfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafag
avkawfaenpqgndpryymrvgmdamkevvrnkinvcgsanri

Sequence, based on observed residues (ATOM records): (download)

>d1gvfb_ c.1.10.2 (B:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli}
siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
dfchsqdcsveaelgrlggvesafltdpqeakrfveltgvdslavaigtahglysktpki
dfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafagavkawfae
npqgndpryymrvgmdamkevvrnkinvcgsanri

SCOP Domain Coordinates for d1gvfb_:

Click to download the PDB-style file with coordinates for d1gvfb_.
(The format of our PDB-style files is described here.)

Timeline for d1gvfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gvfa_