![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins) metal-dependent |
![]() | Protein Tagatose-1,6-bisphosphate aldolase [75087] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75088] (1 PDB entry) |
![]() | Domain d1gvfa_: 1gvf A: [70599] complexed with edo, na, pgh, zn |
PDB Entry: 1gvf (more details), 1.45 Å
SCOPe Domain Sequences for d1gvfa_:
Sequence, based on SEQRES records: (download)
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv dfchsqdcsveaelgrlggveddmsvdaesafltdpqeakrfveltgvdslavaigtahg lysktpkidfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafag avkawfaenpqgndpryymrvgmdamkevvrnkinvcgsanris
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv dfchsqdcsveaelgrlgsafltdpqeakrfveltgvdslavaigtahglysktpkidfq rlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafagavkawfaenpq gndpryymrvgmdamkevvrnkinvcgsanris
Timeline for d1gvfa_: