Lineage for d1gvfa_ (1gvf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085965Family c.1.10.2: Class II FBP aldolase [51591] (3 protein domains)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2085983Protein Tagatose-1,6-bisphosphate aldolase [75087] (1 species)
  7. 2085984Species Escherichia coli [TaxId:562] [75088] (1 PDB entry)
  8. 2085985Domain d1gvfa_: 1gvf A: [70599]
    complexed with edo, na, pgh, zn

Details for d1gvfa_

PDB Entry: 1gvf (more details), 1.45 Å

PDB Description: structure of tagatose-1,6-bisphosphate aldolase
PDB Compounds: (A:) tagatose-bisphosphate aldolase agay

SCOPe Domain Sequences for d1gvfa_:

Sequence, based on SEQRES records: (download)

>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]}
siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
dfchsqdcsveaelgrlggveddmsvdaesafltdpqeakrfveltgvdslavaigtahg
lysktpkidfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafag
avkawfaenpqgndpryymrvgmdamkevvrnkinvcgsanris

Sequence, based on observed residues (ATOM records): (download)

>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]}
siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
dfchsqdcsveaelgrlgsafltdpqeakrfveltgvdslavaigtahglysktpkidfq
rlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafagavkawfaenpq
gndpryymrvgmdamkevvrnkinvcgsanris

SCOPe Domain Coordinates for d1gvfa_:

Click to download the PDB-style file with coordinates for d1gvfa_.
(The format of our PDB-style files is described here.)

Timeline for d1gvfa_: