Lineage for d1gveb_ (1gve B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080970Protein Aflatoxin aldehyde reductase (akr7a1) [75056] (1 species)
  7. 2080971Species Norway rat (Rattus norvegicus) [TaxId:10116] [75057] (1 PDB entry)
  8. 2080973Domain d1gveb_: 1gve B: [70598]
    complexed with cit, gol, nap

Details for d1gveb_

PDB Entry: 1gve (more details), 1.38 Å

PDB Description: aflatoxin aldehyde reductase (akr7a1) from rat liver
PDB Compounds: (B:) aflatoxin b1 aldehyde reductase member 3

SCOPe Domain Sequences for d1gveb_:

Sequence, based on SEQRES records: (download)

>d1gveb_ c.1.7.1 (B:) Aflatoxin aldehyde reductase (akr7a1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arpatvlgamemgrrmdvtsssasvraflqrghteidtafvyangqsetilgdlglglgr
sgckvkiatkaapmfgktlkpadvrfqletslkrlqcprvdlfylhfpdhgtpieetlqa
chqlhqegkfvelglsnyvswevaeictlckkngwimptvyqgmynaitrqvetelfpcl
rhfglrfyafnplagglltgrykyqdkdgknpesrffgnpfsqlymdrywkeehfngial
vekalkttygptapsmisaavrwmyhhsqlkgtqgdavilgmssleqleqnlalveegpl
epavvdafdqawnlvahecpnyfr

Sequence, based on observed residues (ATOM records): (download)

>d1gveb_ c.1.7.1 (B:) Aflatoxin aldehyde reductase (akr7a1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arpatvlgamemgrrmdvtsssasvraflqrghteidtafvyangqsetilgdlglglgr
sgckvkiatkaapmfgktlkpadvrfqletslkrlqcprvdlfylhfpdhgtpieetlqa
chqlhqegkfvelglsnyvswevaeictlckkngwimptvyqgmynaitrqvetelfpcl
rhfglrfyafnplagglltgrykyqywkeehfngialvekalkttygptapsmisaavrw
myhhsqlkgtqgdavilgmssleqleqnlalveegplepavvdafdqawnlvahecpnyf
r

SCOPe Domain Coordinates for d1gveb_:

Click to download the PDB-style file with coordinates for d1gveb_.
(The format of our PDB-style files is described here.)

Timeline for d1gveb_: