Lineage for d1gvea_ (1gve A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 473960Protein Aflatoxin aldehyde reductase (akr7a1) [75056] (1 species)
  7. 473961Species Rat (Rattus norvegicus) [TaxId:10116] [75057] (1 PDB entry)
  8. 473962Domain d1gvea_: 1gve A: [70597]

Details for d1gvea_

PDB Entry: 1gve (more details), 1.38 Å

PDB Description: aflatoxin aldehyde reductase (akr7a1) from rat liver

SCOP Domain Sequences for d1gvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus)}
arpatvlgamemgrrmdvtsssrsvraflqrghteidtafvyangqsetilgdlglglgr
sgckvkiatkaapmfgktlkpadvrfqletslkrlqcprvdlfylhfpdhgtpieetlqa
chqlhqegkfvelglsnyvswevaeictlckkngwimptvyqgmynaitrqvetelfpcl
rhfglrfyafnplagglltgrykyqdkdgknpesrffgnpfsqlymdrywkeehfngial
vekalkttygptapsmisaavrwmyhhsqlkgtqgdavilgmssleqleqnlalveegpl
epavvdafdqawnlvahecpnyfr

SCOP Domain Coordinates for d1gvea_:

Click to download the PDB-style file with coordinates for d1gvea_.
(The format of our PDB-style files is described here.)

Timeline for d1gvea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gveb_