Lineage for d1gv9a_ (1gv9 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 227180Family b.29.1.13: Carbohydrate-recognition domain of P58/ERGIC-53 [74904] (1 protein)
    mammalian protein related to legume lectins
  6. 227181Protein Carbohydrate-recognition domain of P58/ERGIC-53 [74905] (1 species)
  7. 227182Species Rat (Rattus norvegicus) [TaxId:10116] [74906] (1 PDB entry)
  8. 227183Domain d1gv9a_: 1gv9 A: [70596]
    complexed with so4

Details for d1gv9a_

PDB Entry: 1gv9 (more details), 1.46 Å

PDB Description: p58/ergic-53

SCOP Domain Sequences for d1gv9a_:

Sequence, based on SEQRES records: (download)

>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus)}
phrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdndgkkn
npaivvvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvminngft
pdkndyefcakvenmviptqghfgisaatggladdhdvlsfltfqlte

Sequence, based on observed residues (ATOM records): (download)

>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus)}
phrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdnnpaiv
vvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvminngftpdknd
yefcakvenmviptqghfgisaatggladdhdvlsfltfqlte

SCOP Domain Coordinates for d1gv9a_:

Click to download the PDB-style file with coordinates for d1gv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gv9a_: