Lineage for d1gv4b3 (1gv4 B:478-610)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194320Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 194321Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 194322Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins)
  6. 194323Protein Apoptosis-inducing factor (AIF) [75489] (2 species)
  7. 194326Species Mouse (Mus musculus) [TaxId:10090] [75491] (1 PDB entry)
  8. 194328Domain d1gv4b3: 1gv4 B:478-610 [70594]
    Other proteins in same PDB: d1gv4a1, d1gv4a2, d1gv4b1, d1gv4b2

Details for d1gv4b3

PDB Entry: 1gv4 (more details), 2 Å

PDB Description: murine apoptosis-inducing factor (aif)

SCOP Domain Sequences for d1gv4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv4b3 d.87.1.1 (B:478-610) Apoptosis-inducing factor (AIF) {Mouse (Mus musculus)}
qsmfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetesea
seitippsapavpqvpvegedygkgvifylrdkvvvgivlwnvfnrmpiarkiikdgeqh
edlnevaklfnih

SCOP Domain Coordinates for d1gv4b3:

Click to download the PDB-style file with coordinates for d1gv4b3.
(The format of our PDB-style files is described here.)

Timeline for d1gv4b3: