Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Apoptosis-inducing factor (AIF) [75126] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [75128] (1 PDB entry) |
Domain d1gv4b2: 1gv4 B:265-397 [70593] Other proteins in same PDB: d1gv4a3, d1gv4b3 complexed with fad |
PDB Entry: 1gv4 (more details), 2 Å
SCOP Domain Sequences for d1gv4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gv4b2 c.3.1.5 (B:265-397) Apoptosis-inducing factor (AIF) {Mouse (Mus musculus)} slsaidragaevksrttlfrkigdfralekisrevksitvigggflgselacalgrksqa sgieviqlfpekgnmgkilpqylsnwtmekvkregvkvmpnaivqsvgvsggrlliklkd grkvetdhivtav
Timeline for d1gv4b2: