Lineage for d1gv4b1 (1gv4 B:121-264,B:398-477)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176396Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
  6. 176404Protein Apoptosis-inducing factor (AIF) [75126] (2 species)
  7. 176408Species Mouse (Mus musculus) [TaxId:10090] [75128] (1 PDB entry)
  8. 176411Domain d1gv4b1: 1gv4 B:121-264,B:398-477 [70592]
    Other proteins in same PDB: d1gv4a3, d1gv4b3

Details for d1gv4b1

PDB Entry: 1gv4 (more details), 2 Å

PDB Description: murine apoptosis-inducing factor (aif)

SCOP Domain Sequences for d1gv4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv4b1 c.3.1.5 (B:121-264,B:398-477) Apoptosis-inducing factor (AIF) {Mouse (Mus musculus)}
tvpqirapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwf
sddpnvtktlqfrqwngkersiyfqppsfyvsaqdlpnienggvavltgkkvvhldvrgn
mvklndgsqitfekcliatggtprXglepnvelaktggleidsdfggfrvnaelqarsni
wvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywh

SCOP Domain Coordinates for d1gv4b1:

Click to download the PDB-style file with coordinates for d1gv4b1.
(The format of our PDB-style files is described here.)

Timeline for d1gv4b1: