Lineage for d1gv4a3 (1gv4 A:478-610)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962838Protein Apoptosis-inducing factor (AIF) [75489] (2 species)
    contains a large loop insertion in this domain
  7. 2962842Species Mouse (Mus musculus) [TaxId:10090] [75491] (1 PDB entry)
  8. 2962843Domain d1gv4a3: 1gv4 A:478-610 [70591]
    Other proteins in same PDB: d1gv4a1, d1gv4a2, d1gv4b1, d1gv4b2
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1gv4a3

PDB Entry: 1gv4 (more details), 2 Å

PDB Description: murine apoptosis-inducing factor (aif)
PDB Compounds: (A:) programed cell death protein 8

SCOPe Domain Sequences for d1gv4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv4a3 d.87.1.1 (A:478-610) Apoptosis-inducing factor (AIF) {Mouse (Mus musculus) [TaxId: 10090]}
qsmfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetesea
seitippsapavpqvpvegedygkgvifylrdkvvvgivlwnvfnrmpiarkiikdgeqh
edlnevaklfnih

SCOPe Domain Coordinates for d1gv4a3:

Click to download the PDB-style file with coordinates for d1gv4a3.
(The format of our PDB-style files is described here.)

Timeline for d1gv4a3: