Lineage for d1gv4a2 (1gv4 A:265-397)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833162Protein Apoptosis-inducing factor (AIF) [75126] (2 species)
  7. 1833168Species Mouse (Mus musculus) [TaxId:10090] [75128] (1 PDB entry)
  8. 1833170Domain d1gv4a2: 1gv4 A:265-397 [70590]
    Other proteins in same PDB: d1gv4a3, d1gv4b3
    complexed with fad

Details for d1gv4a2

PDB Entry: 1gv4 (more details), 2 Å

PDB Description: murine apoptosis-inducing factor (aif)
PDB Compounds: (A:) programed cell death protein 8

SCOPe Domain Sequences for d1gv4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv4a2 c.3.1.5 (A:265-397) Apoptosis-inducing factor (AIF) {Mouse (Mus musculus) [TaxId: 10090]}
slsaidragaevksrttlfrkigdfralekisrevksitvigggflgselacalgrksqa
sgieviqlfpekgnmgkilpqylsnwtmekvkregvkvmpnaivqsvgvsggrlliklkd
grkvetdhivtav

SCOPe Domain Coordinates for d1gv4a2:

Click to download the PDB-style file with coordinates for d1gv4a2.
(The format of our PDB-style files is described here.)

Timeline for d1gv4a2: