SCOPe 2.05: Domain d1gv3b2: 1gv3 B:127-237

Lineage for d1gv3b2 (1gv3 B:127-237)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Anabaena sp. [TaxId:1167] [75409] (1 PDB entry)

8. Domain d1gv3b2: 1gv3 B:127-237 [70588]
   Other proteins in same PDB: d1gv3a1, d1gv3b1
   complexed with mn

Details for d1gv3b2

PDB Entry: 1gv3, 2 Å

PDB Description: the 2.0 angstrom resolution structure of the catalytic portion of a cyanobacterial membrane-bound manganese superoxide dismutase

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1gv3b2:

Sequence; same for both SEQRES and ATOM records:

>d1gv3b2 d.44.1.1 (B:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]}
dgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqd
npimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqas

Timeline for d1gv3b2:

• d1gv3b2 first appeared in SCOP 1.61
  
• d1gv3b2 appears in SCOPe 2.04
  
• d1gv3b2 appears in SCOPe 2.06
  
• d1gv3b2 appears in the current release, SCOPe 2.08