Lineage for d1gv3b1 (1gv3 B:25-126)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437559Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 437560Species Anabaena sp. [74666] (1 PDB entry)
  8. 437562Domain d1gv3b1: 1gv3 B:25-126 [70587]
    Other proteins in same PDB: d1gv3a2, d1gv3b2

Details for d1gv3b1

PDB Entry: 1gv3 (more details), 2 Å

PDB Description: the 2.0 angstrom resolution structure of the catalytic portion of a cyanobacterial membrane-bound manganese superoxide dismutase

SCOP Domain Sequences for d1gv3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv3b1 a.2.11.1 (B:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp.}
sigfidrqlgtnpaelpplpygydalekaidaetmklhhdkhhaayvnnlnnalkkhpel
qnssveallrdlnsvpedirttvrnnggghlnhtifwqimsp

SCOP Domain Coordinates for d1gv3b1:

Click to download the PDB-style file with coordinates for d1gv3b1.
(The format of our PDB-style files is described here.)

Timeline for d1gv3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv3b2