Lineage for d1guwa_ (1guw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055586Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2055631Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 2055649Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (4 PDB entries)
  8. 2055652Domain d1guwa_: 1guw A: [70584]
    Chromo domain complexed with the lysine 9-methyl histone H3 N-terminal peptide

Details for d1guwa_

PDB Entry: 1guw (more details)

PDB Description: structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
PDB Compounds: (A:) chromobox protein homolog 1

SCOPe Domain Sequences for d1guwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
lqsqktahetdks

SCOPe Domain Coordinates for d1guwa_:

Click to download the PDB-style file with coordinates for d1guwa_.
(The format of our PDB-style files is described here.)

Timeline for d1guwa_: