SCOP 1.69: Domain d1gu6c_: 1gu6 C:

Lineage for d1gu6c_ (1gu6 C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Escherichia coli [TaxId:562] [74807] (1 PDB entry)

8. Domain d1gu6c_: 1gu6 C: [70576]

Details for d1gu6c_

PDB Entry: 1gu6, 2.5 Å

PDB Description: structure of the periplasmic cytochrome c nitrite reductase from escherichia coli

SCOP Domain Sequences for d1gu6c_:

Sequence; same for both SEQRES and ATOM records:

>d1gu6c_ a.138.1.3 (C:) Cytochrome c nitrite reductase {Escherichia coli}
veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa
vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn
lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy
fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk
nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin
dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee
glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd
fiktvipqweeqarkngllsq

Timeline for d1gu6c_:

• d1gu6c_ first appeared in SCOP 1.61
  
• d1gu6c_ appears in SCOP 1.67
  
• d1gu6c_ appears in SCOP 1.71
  
• d1gu6c_ appears in the current release, SCOPe 2.08