Lineage for d1gu6c_ (1gu6 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012738Family a.138.1.3: Di-heme elbow motif [48711] (8 protein domains)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2012739Protein Cytochrome c nitrite reductase [48718] (5 species)
  7. 2012748Species Escherichia coli [TaxId:562] [74807] (1 PDB entry)
  8. 2012750Domain d1gu6c_: 1gu6 C: [70576]
    complexed with ca, gol, hec

Details for d1gu6c_

PDB Entry: 1gu6 (more details), 2.5 Å

PDB Description: structure of the periplasmic cytochrome c nitrite reductase from escherichia coli
PDB Compounds: (C:) cytochrome c552

SCOPe Domain Sequences for d1gu6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu6c_ a.138.1.3 (C:) Cytochrome c nitrite reductase {Escherichia coli [TaxId: 562]}
veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa
vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn
lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy
fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk
nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin
dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee
glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd
fiktvipqweeqarkngllsq

SCOPe Domain Coordinates for d1gu6c_:

Click to download the PDB-style file with coordinates for d1gu6c_.
(The format of our PDB-style files is described here.)

Timeline for d1gu6c_: