Lineage for d1gu6a_ (1gu6 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778614Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 778615Protein Cytochrome c nitrite reductase [48718] (4 species)
  7. 778619Species Escherichia coli [TaxId:562] [74807] (2 PDB entries)
  8. 778624Domain d1gu6a_: 1gu6 A: [70575]

Details for d1gu6a_

PDB Entry: 1gu6 (more details), 2.5 Å

PDB Description: structure of the periplasmic cytochrome c nitrite reductase from escherichia coli
PDB Compounds: (A:) cytochrome c552

SCOP Domain Sequences for d1gu6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu6a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Escherichia coli [TaxId: 562]}
veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa
vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn
lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy
fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk
nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin
dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee
glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd
fiktvipqweeqarkngllsq

SCOP Domain Coordinates for d1gu6a_:

Click to download the PDB-style file with coordinates for d1gu6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gu6a_: