Lineage for d1gu1j_ (1gu1 J:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579298Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 579299Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 579300Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 579346Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 579368Domain d1gu1j_: 1gu1 J: [70572]

Details for d1gu1j_

PDB Entry: 1gu1 (more details), 1.8 Å

PDB Description: Crystal structure of type II dehydroquinase from Streptomyces coelicolor complexed with 2,3-anhydro-quinic acid

SCOP Domain Sequences for d1gu1j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu1j_ c.23.13.1 (J:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gu1j_:

Click to download the PDB-style file with coordinates for d1gu1j_.
(The format of our PDB-style files is described here.)

Timeline for d1gu1j_: