Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein Type II 3-dehydroquinate dehydratase [52306] (6 species) |
Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries) |
Domain d1gu1d_: 1gu1 D: [70566] complexed with fa1, gol, tla, trs |
PDB Entry: 1gu1 (more details), 1.8 Å
SCOPe Domain Sequences for d1gu1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gu1d_ c.23.13.1 (D:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]} rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy vsqradgvvagcgvqgyvfgveriaalag
Timeline for d1gu1d_: