SCOP 1.61: Domain d1gu0h_: 1gu0 H:

Lineage for d1gu0h_ (1gu0 H:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)

8. Domain d1gu0h_: 1gu0 H: [70558]

Details for d1gu0h_

PDB Entry: 1gu0, 2 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor

SCOP Domain Sequences for d1gu0h_:

Sequence; same for both SEQRES and ATOM records:

>d1gu0h_ c.23.13.1 (H:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

Timeline for d1gu0h_:

• d1gu0h_ is new in SCOP 1.61
  
• d1gu0h_ appears in SCOP 1.63
  
• d1gu0h_ appears in the current release, SCOPe 2.08