Lineage for d1gu0g_ (1gu0 G:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178108Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 178109Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 178110Protein Type II 3-dehydroquinate dehydratase [52306] (2 species)
  7. 178113Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 178156Domain d1gu0g_: 1gu0 G: [70557]

Details for d1gu0g_

PDB Entry: 1gu0 (more details), 2 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor

SCOP Domain Sequences for d1gu0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu0g_ c.23.13.1 (G:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gu0g_:

Click to download the PDB-style file with coordinates for d1gu0g_.
(The format of our PDB-style files is described here.)

Timeline for d1gu0g_: