Lineage for d1gu0e_ (1gu0 E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116843Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2116844Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2116845Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2116909Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 2116950Domain d1gu0e_: 1gu0 E: [70555]
    complexed with trs

Details for d1gu0e_

PDB Entry: 1gu0 (more details), 2 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor
PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1gu0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu0e_ c.23.13.1 (E:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOPe Domain Coordinates for d1gu0e_:

Click to download the PDB-style file with coordinates for d1gu0e_.
(The format of our PDB-style files is described here.)

Timeline for d1gu0e_: