Lineage for d1gtzl_ (1gtz L:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178108Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 178109Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 178110Protein Type II 3-dehydroquinate dehydratase [52306] (2 species)
  7. 178113Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 178125Domain d1gtzl_: 1gtz L: [70550]

Details for d1gtzl_

PDB Entry: 1gtz (more details), 1.6 Å

PDB Description: structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate

SCOP Domain Sequences for d1gtzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtzl_ c.23.13.1 (L:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gtzl_:

Click to download the PDB-style file with coordinates for d1gtzl_.
(The format of our PDB-style files is described here.)

Timeline for d1gtzl_: