Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) |
Protein Type II 3-dehydroquinate dehydratase [52306] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries) |
Domain d1gtzj_: 1gtz J: [70548] |
PDB Entry: 1gtz (more details), 1.6 Å
SCOP Domain Sequences for d1gtzj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtzj_ c.23.13.1 (J:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor} rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy vsqradgvvagcgvqgyvfgveriaalag
Timeline for d1gtzj_: