Lineage for d1gtzi_ (1gtz I:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579298Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 579299Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 579300Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 579346Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 579355Domain d1gtzi_: 1gtz I: [70547]

Details for d1gtzi_

PDB Entry: 1gtz (more details), 1.6 Å

PDB Description: structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate

SCOP Domain Sequences for d1gtzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtzi_ c.23.13.1 (I:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gtzi_:

Click to download the PDB-style file with coordinates for d1gtzi_.
(The format of our PDB-style files is described here.)

Timeline for d1gtzi_: