| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) ![]() |
| Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) |
| Protein Type II 3-dehydroquinate dehydratase [52306] (5 species) |
| Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries) |
| Domain d1gtzh_: 1gtz H: [70546] |
PDB Entry: 1gtz (more details), 1.6 Å
SCOP Domain Sequences for d1gtzh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtzh_ c.23.13.1 (H:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag
Timeline for d1gtzh_: