Lineage for d1gtzg_ (1gtz G:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) 
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) Protein Type II 3-dehydroquinate dehydratase [52306] (2 species) Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries) 
Domain d1gtzg_: 1gtz G: [70545]
Details for d1gtzg_
PDB Entry: 1gtz (more details), 1.6 Å
PDB Description: structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate
SCOP Domain Sequences for d1gtzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtzg_ c.23.13.1 (G:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag
SCOP Domain Coordinates for d1gtzg_:
Click to download the PDB-style file with coordinates for d1gtzg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtzg_:
- d1gtzg_ is new in SCOP 1.61
- d1gtzg_ appears in SCOP 1.63
- d1gtzg_ appears in the current release, SCOPe 2.08
View in 3D
