Lineage for d1gtze_ (1gtz E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826558Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 826559Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 826560Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 826619Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries)
  8. 826624Domain d1gtze_: 1gtz E: [70543]

Details for d1gtze_

PDB Entry: 1gtz (more details), 1.6 Å

PDB Description: structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate
PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOP Domain Sequences for d1gtze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtze_ c.23.13.1 (E:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gtze_:

Click to download the PDB-style file with coordinates for d1gtze_.
(The format of our PDB-style files is described here.)

Timeline for d1gtze_: