Lineage for d1gtze_ (1gtz E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857823Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2857887Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 2857892Domain d1gtze_: 1gtz E: [70543]
    complexed with dhk, trs; mutant

Details for d1gtze_

PDB Entry: 1gtz (more details), 1.6 Å

PDB Description: structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate
PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1gtze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtze_ c.23.13.1 (E:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOPe Domain Coordinates for d1gtze_:

Click to download the PDB-style file with coordinates for d1gtze_.
(The format of our PDB-style files is described here.)

Timeline for d1gtze_: