Lineage for d1gtvb_ (1gtv B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313182Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 313352Protein Thymidylate kinase [52563] (4 species)
  7. 313390Species Mycobacterium tuberculosis [TaxId:1773] [69482] (9 PDB entries)
  8. 313393Domain d1gtvb_: 1gtv B: [70538]
    complexed with act, mg, so4, tmp, tyd

Details for d1gtvb_

PDB Entry: 1gtv (more details), 1.55 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)

SCOP Domain Sequences for d1gtvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtvb_ c.37.1.1 (B:) Thymidylate kinase {Mycobacterium tuberculosis}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

SCOP Domain Coordinates for d1gtvb_:

Click to download the PDB-style file with coordinates for d1gtvb_.
(The format of our PDB-style files is described here.)

Timeline for d1gtvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gtva_