Lineage for d1gtvb_ (1gtv B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) 
Protein Thymidylate kinase [52563] (4 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [69482] (3 PDB entries) 
Domain d1gtvb_: 1gtv B: [70538]
Details for d1gtvb_
PDB Entry: 1gtv (more details), 1.55 Å
PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
SCOP Domain Sequences for d1gtvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtvb_ c.37.1.1 (B:) Thymidylate kinase {Mycobacterium tuberculosis}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla
SCOP Domain Coordinates for d1gtvb_:
Click to download the PDB-style file with coordinates for d1gtvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtvb_:
- d1gtvb_ is new in SCOP 1.61
- d1gtvb_ appears in SCOP 1.63
- d1gtvb_ appears in the current release, SCOPe 2.08
View in 3D
