Lineage for d1gtva_ (1gtv A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179330Species Mycobacterium tuberculosis [TaxId:1773] [69482] (3 PDB entries)
  8. 179332Domain d1gtva_: 1gtv A: [70537]

Details for d1gtva_

PDB Entry: 1gtv (more details), 1.55 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)

SCOP Domain Sequences for d1gtva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtva_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

SCOP Domain Coordinates for d1gtva_:

Click to download the PDB-style file with coordinates for d1gtva_.
(The format of our PDB-style files is described here.)

Timeline for d1gtva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gtvb_