SCOP 1.61: Domain d1gtnm_: 1gtn M:

Lineage for d1gtnm_ (1gtn M:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family)

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)

8. Domain d1gtnm_: 1gtn M: [70519]

Details for d1gtnm_

PDB Entry: 1gtn, 2.5 Å

PDB Description: structure of the trp rna-binding attenuation protein (trap) bound to an rna molecule containing 11 gagcc repeats

SCOP Domain Sequences for d1gtnm_:

Sequence; same for both SEQRES and ATOM records:

>d1gtnm_ b.82.5.1 (M:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgviesegk

Timeline for d1gtnm_:

• d1gtnm_ is new in SCOP 1.61
  
• d1gtnm_ appears in SCOP 1.63
  
• d1gtnm_ appears in the current release, SCOPe 2.08