Lineage for d1gtne_ (1gtn E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331659Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 1331660Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 1331661Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 1331662Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)
  8. 1331792Domain d1gtne_: 1gtn E: [70511]
    protein/RNA complex; complexed with trp

Details for d1gtne_

PDB Entry: 1gtn (more details), 2.5 Å

PDB Description: structure of the trp rna-binding attenuation protein (trap) bound to an rna molecule containing 11 gagcc repeats
PDB Compounds: (E:) trp RNA-binding attenuation protein

SCOPe Domain Sequences for d1gtne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtne_ b.82.5.1 (E:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvieseg

SCOPe Domain Coordinates for d1gtne_:

Click to download the PDB-style file with coordinates for d1gtne_.
(The format of our PDB-style files is described here.)

Timeline for d1gtne_: