| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (6 proteins) |
| Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries) |
| Domain d1gthd5: 1gth D:845-1020 [70502] Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha4, d1gthb1, d1gthb2, d1gthb3, d1gthb4, d1gthc1, d1gthc2, d1gthc3, d1gthc4, d1gthd1, d1gthd2, d1gthd3, d1gthd4 |
PDB Entry: 1gth (more details), 2.25 Å
SCOP Domain Sequences for d1gthd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gthd5 d.58.1.5 (D:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
Timeline for d1gthd5:
View in 3DDomains from same chain: (mouse over for more information) d1gthd1, d1gthd2, d1gthd3, d1gthd4 |